## ----options, include=FALSE--------------------------------------------------- options(width = 80) options(digits = 6) ## ----HTML, include=FALSE------------------------------------------------------ ## Some frequently used HTML expressions logfO2 <- "logfO2" # Use lowercase here because these tend to be variable names in the examples zc <- "ZC" o2 <- "O2" h2o <- "H2O" sio2 <- "SiO2" ch4 <- "CH4" ## ----setup, include=FALSE----------------------------------------------------- library(knitr) ## From "Tufte Handout" example dated 2016-12-27 # Invalidate cache when the tufte version changes opts_chunk$set(tidy = FALSE, cache.extra = packageVersion('tufte')) options(htmltools.dir.version = FALSE) ## Adjust plot margins ## First one from https://yihui.name/knitr/hooks/ knit_hooks$set(small.mar = function(before, options, envir) { if (before) par(mar = c(4.2, 4.2, .1, .1)) # smaller margin on top and right }) knit_hooks$set(tiny.mar = function(before, options, envir) { if (before) par(mar = c(.1, .1, .1, .1)) # tiny margin all around }) knit_hooks$set(smallish.mar = function(before, options, envir) { if (before) par(mar = c(4.2, 4.2, 0.9, 0.9)) # smallish margins on top and right }) ## Use pngquant to optimize PNG images knit_hooks$set(pngquant = hook_pngquant) pngquant <- "--speed=1 --quality=0-25" # pngquant isn't available on R-Forge ... if (!nzchar(Sys.which("pngquant"))) pngquant <- NULL # Set dpi 20231129 knitr::opts_chunk$set( dpi = if(nzchar(Sys.getenv("CHNOSZ_BUILD_LARGE_VIGNETTES"))) 72 else 50 ) hidpi = if(nzchar(Sys.getenv("CHNOSZ_BUILD_LARGE_VIGNETTES"))) 100 else 50 ## http://stackoverflow.com/questions/23852753/knitr-with-gridsvg ## Set up a chunk hook for manually saved plots. knit_hooks$set(custom.plot = hook_plot_custom) ## Hook to change to -- required for interactive SVG hook_plot <- knit_hooks$get("plot") knit_hooks$set(plot = function(x, options) { x <- hook_plot(x, options) if (!is.null(options$embed.tag) && options$embed.tag) x <- gsub("%s', color, x) } knit_hooks$set(warning = color_block('magenta'), error = color_block('red'), message = color_block('blue')) ## ----install_CHNOSZ, eval=FALSE----------------------------------------------- # install.packages("CHNOSZ") ## ----library_CHNOSZ----------------------------------------------------------- library(CHNOSZ) ## ----reset-------------------------------------------------------------------- reset() ## ----pseudocode, eval=FALSE--------------------------------------------------- # basis(...) # species(...) # a <- affinity(...) # e <- equilibrate(a) ## optional # diagram(e) ## or diagram(a) # reset() ## clear settings for next calculation ## ----info_CH4----------------------------------------------------------------- info("CH4") ## ----info_CH4_gas------------------------------------------------------------- info("CH4", "gas") ## ----info_names_gas----------------------------------------------------------- info("methane") info("oxygen") info("carbon dioxide") ## ----info_S_S2---------------------------------------------------------------- info("S") info("S2") ## ----iCH4, message=FALSE------------------------------------------------------ iCH4 <- info("CH4") info(iCH4) ## ----info_info_water---------------------------------------------------------- info(info("water")) ## ----width180, include=FALSE------------------------------------------------------------------------------------------------------------------------------------------------------ options(width = 180) ## ----info_acid-------------------------------------------------------------------------------------------------------------------------------------------------------------------- info("acid") ## ----width80, include=FALSE--------------------------------------------------- options(width = 80) ## ----info_ribose-------------------------------------------------------------- info(" ribose") ## ----info_CH4_formula, message=FALSE------------------------------------------ info(iCH4)$formula ## ----makeup_iCH4-------------------------------------------------------------- makeup(iCH4) as.chemical.formula(makeup(iCH4)) ## ----ZC_iCH4, message=FALSE--------------------------------------------------- ZC(iCH4) ZC(info(iCH4)$formula) ZC(makeup(iCH4)) ## ----subcrt_water------------------------------------------------------------- subcrt("water") ## ----subcrt_water_grid-------------------------------------------------------- subcrt("water", T = c(400, 500, 600), P = c(200, 400, 600), grid = "P")$out$water ## ----subcrt_water_plot, fig.margin=TRUE, fig.width=4, fig.height=4, small.mar=TRUE, out.width="100%", echo=FALSE, message=FALSE, fig.cap="Isothermal contours of density (g cm-3) and pressure (bar) of water.", cache=TRUE, pngquant=pngquant, timeit=timeit---- sres <- subcrt("water", T=seq(0,1000,100), P=c(NA, seq(1,500,1)), grid="T") water <- sres$out$water plot(water$P, water$rho, type = "l") ## ----subcrt_water_plot, eval=FALSE-------------------------------------------- # sres <- subcrt("water", T=seq(0,1000,100), P=c(NA, seq(1,500,1)), grid="T") # water <- sres$out$water # plot(water$P, water$rho, type = "l") ## ----units_CH4---------------------------------------------------------------- T.units("K") P.units("MPa") subcrt("CH4", T = 298.15, P = 0.1)$out$CH4$G E.units("cal") subcrt("CH4", T = 298.15, P = 0.1)$out$CH4$G ## ----convert_G, message=FALSE------------------------------------------------- (CH4dat <- info(info("CH4"))) convert(CH4dat$G, "J") ## ----reset-------------------------------------------------------------------- reset() ## ----subcrt_CO2--------------------------------------------------------------- subcrt(c("CO2", "CO2"), c("gas", "aq"), c(-1, 1), T = seq(0, 250, 50)) ## ----CO2_logK, echo=FALSE, message=FALSE-------------------------------------- T <- seq(0, 350, 10) CO2 <- subcrt(c("CO2", "CO2"), c("gas", "aq"), c(-1, 1), T = T)$out$logK CO <- subcrt(c("CO", "CO"), c("gas", "aq"), c(-1, 1), T = T)$out$logK CH4 <- subcrt(c("CH4", "CH4"), c("gas", "aq"), c(-1, 1), T = T)$out$logK logK <- data.frame(T, CO2, CO, CH4) ## ----CO2_plot, fig.margin=TRUE, fig.width=4, fig.height=4, small.mar=TRUE, out.width="100%", echo=FALSE, message=FALSE, fig.cap="Calculated equilibrium constants for dissolution of CO2, CO, and CH4.", cache=TRUE, pngquant=pngquant, timeit=timeit---- matplot(logK[, 1], logK[, -1], type = "l", col = 1, lty = 1, xlab = axis.label("T"), ylab = axis.label("logK")) text(80, -1.7, expr.species("CO2")) text(240, -2.37, expr.species("CO")) text(300, -2.57, expr.species("CH4")) ## ----CO2_logK, eval=FALSE----------------------------------------------------- # T <- seq(0, 350, 10) # CO2 <- subcrt(c("CO2", "CO2"), c("gas", "aq"), c(-1, 1), T = T)$out$logK # CO <- subcrt(c("CO", "CO"), c("gas", "aq"), c(-1, 1), T = T)$out$logK # CH4 <- subcrt(c("CH4", "CH4"), c("gas", "aq"), c(-1, 1), T = T)$out$logK # logK <- data.frame(T, CO2, CO, CH4) ## ----CO2_plot, eval=FALSE----------------------------------------------------- # matplot(logK[, 1], logK[, -1], type = "l", col = 1, lty = 1, # xlab = axis.label("T"), ylab = axis.label("logK")) # text(80, -1.7, expr.species("CO2")) # text(240, -2.37, expr.species("CO")) # text(300, -2.57, expr.species("CH4")) ## ----subcrt_unbalanced, results="hide"---------------------------------------- subcrt(c("CO2", "CH4"), c(-1, 1)) ## ----basis_singular, error=TRUE----------------------------------------------- basis(c("CO2", "H2", "H2CO2")) ## ----basis_CHO---------------------------------------------------------------- basis(c("CO2", "H2", "H2O")) ## ----basis_CHOZ--------------------------------------------------------------- basis(c("CO2", "H2", "H2O", "H+")) ## ----subcrt_acetoclastic, message=FALSE--------------------------------------- subcrt(c("acetate", "CH4"), c(-1, 1))$reaction ## ----subcrt_methanogenesis, message=FALSE------------------------------------- acetate_oxidation <- subcrt("acetate", -1) hydrogenotrophic <- subcrt("CH4", 1) acetoclastic <- subcrt(c("acetate", "CH4"), c(-1, 1)) ## ----describe_reaction_plot, fig.margin=TRUE, fig.width=3.5, fig.height=1.8, tiny.mar=TRUE, out.width="100%", pngquant=pngquant, timeit=timeit---- plot(0, 0, type = "n", axes = FALSE, ann=FALSE, xlim=c(0, 5), ylim=c(5.2, -0.2)) text(0, 0, "acetoclastic methanogenesis", adj = 0) text(5, 1, describe.reaction(acetoclastic$reaction), adj = 1) text(0, 2, "acetate oxidation", adj = 0) text(5, 3, describe.reaction(acetate_oxidation$reaction), adj = 1) text(0, 4, "hydrogenotrophic methanogenesis", adj = 0) text(5, 5, describe.reaction(hydrogenotrophic$reaction), adj = 1) ## ----basis_mayumi, message=FALSE, results="hide"------------------------------ basis(c("CO2", "H2", "H2O", "H+")) basis(c("CO2", "H2"), "gas") basis(c("H2", "pH"), c(-3.92, 7.3)) ## ----affinity_acetoclastic, message=FALSE------------------------------------- subcrt(c("acetate", "CH4"), c(-1, 1), c("aq", "gas"), logact = c(-3.4, -0.18), T = 55, P = 50)$out ## ----affinity_hydrogenotrophic, message=FALSE--------------------------------- subcrt("CH4", 1, "gas", logact = -0.18, T = 55, P = 50)$out ## ----rxnfun, message=FALSE---------------------------------------------------- rxnfun <- function(coeffs) { subcrt(c("acetate", "CH4"), coeffs, c("aq", "gas"), logact = c(-3.4, -0.18), T = 55, P = 50)$out } ## ----methanogenesis_plot, fig.margin=TRUE, fig.width=4.1, fig.height=4.1, small.mar=TRUE, out.width="100%", echo=FALSE, message=FALSE, fig.cap="Gibbs energies of acetate oxidation and methanogenesis (after Mayumi et al., 2013).", cache=TRUE, pngquant=pngquant, timeit=timeit---- Adat <- lapply(c(-3, 3), function(logfCO2) { basis("CO2", logfCO2) data.frame(logfCO2, rxnfun(c(0, 0))$A, rxnfun(c(-1, 0))$A, rxnfun(c(-1, 1))$A, rxnfun(c(0, 1))$A ) }) Adat <- do.call(rbind, Adat) matplot(Adat[, 1], -Adat[, -1]/1000, type = "l", lty = 1, lwd = 2, xlab = axis.label("CO2"), ylab = axis.label("DG", prefix = "k")) legend("topleft", c("acetate oxidation", "acetoclastic methanogenesis", "hydrogenotrophic methanogenesis"), lty = 1, col = 2:4) ## ----methanogenesis_plot, eval=FALSE------------------------------------------ # Adat <- lapply(c(-3, 3), function(logfCO2) { # basis("CO2", logfCO2) # data.frame(logfCO2, # rxnfun(c(0, 0))$A, # rxnfun(c(-1, 0))$A, # rxnfun(c(-1, 1))$A, # rxnfun(c(0, 1))$A # ) # }) # Adat <- do.call(rbind, Adat) # matplot(Adat[, 1], -Adat[, -1]/1000, type = "l", lty = 1, lwd = 2, # xlab = axis.label("CO2"), ylab = axis.label("DG", prefix = "k")) # legend("topleft", c("acetate oxidation", "acetoclastic methanogenesis", # "hydrogenotrophic methanogenesis"), lty = 1, col = 2:4) ## ----reset, message=FALSE----------------------------------------------------- reset() ## ----basis_CHNOSZ, results="hide"--------------------------------------------- basis("CHNOSe") ## ----species_sulfur----------------------------------------------------------- species(c("H2S", "HS-", "HSO4-", "SO4-2")) ## ----affinity----------------------------------------------------------------- unlist(affinity()$values) ## ----EhpH_plot, fig.margin=TRUE, fig.width=4, fig.height=4, out.width="100%", echo = FALSE, message=FALSE, cache=TRUE, fig.cap="Aqueous sulfur species at 25 °C.", pngquant=pngquant, timeit=timeit---- a <- affinity(pH = c(0, 12), Eh = c(-0.5, 1)) diagram(a, limit.water = TRUE) ## ----EhpH_plot, echo=TRUE, eval=FALSE----------------------------------------- # a <- affinity(pH = c(0, 12), Eh = c(-0.5, 1)) # diagram(a, limit.water = TRUE) ## ----EhpH_plot_color, fig.margin=TRUE, fig.width=4, fig.height=4, smallish.mar=TRUE, out.width="100%", echo=FALSE, message=FALSE, cache=TRUE, fig.cap="The same plot, with different colors and labels.", pngquant=pngquant, timeit=timeit---- diagram(a, fill = "terrain", lwd = 2, lty = 3, names = c("hydrogen sulfide", "bisulfide", "bisulfate", "sulfate"), las = 0) water.lines(a, col = 6, lwd = 2) ## ----EhpH_plot_color, echo=TRUE, eval=FALSE----------------------------------- # diagram(a, fill = "terrain", lwd = 2, lty = 3, # names = c("hydrogen sulfide", "bisulfide", "bisulfate", "sulfate"), # las = 0) # water.lines(a, col = 6, lwd = 2) ## ----retrieve----------------------------------------------------------------- retrieve("Mn", c("O", "H"), "aq") retrieve("Mn", c("O", "H"), "cr") ## ----retrieve_diagram, fig.margin=TRUE, fig.width=5, fig.height=5, out.width="100%", message=FALSE, results = "hide", cache=TRUE, fig.cap="Eh-pH diagram for the Mn-O-H system.", pngquant=pngquant, timeit=timeit---- # Set decimal logarithm of activity of aqueous species, # temperature and plot resolution logact <- -4 T <- 100 res <- 400 # Start with the aqueous species basis(c("Mn+2", "H2O", "H+", "e-")) iaq <- retrieve("Mn", c("O", "H"), "aq") species(iaq, logact) aaq <- affinity(pH = c(4, 16, res), Eh = c(-1.5, 1.5, res), T = T) # Show names for only the metastable species here names <- names(iaq) names[!names(iaq) %in% c("MnOH+", "MnO", "HMnO2-")] <- "" diagram(aaq, lty = 2, col = "#4169E188", names = names, col.names = 4) # Overlay mineral stability fields icr <- retrieve("Mn", c("O", "H"), "cr") species(icr, add = TRUE) # Supply the previous result from affinity() to use # argument recall (for plotted variables and T) acr <- affinity(aaq) diagram(acr, add = TRUE, bold = acr$species$state=="cr", limit.water = FALSE) # Add legend legend <- c( bquote(log * italic(a)["Mn(aq)"] == .(logact)), bquote(italic(T) == .(T) ~ degree*C) ) legend("topright", legend = as.expression(legend), bty = "n") ## ----info_CuCl, results="hide"------------------------------------------------ info(" CuCl") ## ----copper_setup, echo=TRUE, results="hide"---------------------------------- basis(c("Cu", "H2S", "Cl-", "H2O", "H+", "e-")) basis("H2S", -6) basis("Cl-", -0.7) species(c("CuCl", "CuCl2-", "CuCl3-2", "CuCl+", "CuCl2", "CuCl3-", "CuCl4-2")) species(c("chalcocite", "tenorite", "cuprite", "copper"), add = TRUE) ## ----info_chalcocite, message=FALSE------------------------------------------- info(info("chalcocite", c("cr", "cr2", "cr3")))$T ## ----copper_mosaic, fig.margin=TRUE, fig.width=4, fig.height=4, out.width="100%", message=FALSE, cache=TRUE, fig.cap="Copper minerals and aqueous complexes with chloride, 200 °C.", pngquant=pngquant, timeit=timeit---- T <- 200 res <- 200 bases <- c("H2S", "HS-", "HSO4-", "SO4-2") m1 <- mosaic(bases, pH = c(0, 12, res), Eh=c(-1.2, 0.75, res), T=T) diagram(m1$A.species, lwd = 2) diagram(m1$A.bases, add = TRUE, col = 4, col.names = 4, lty = 3, italic = TRUE) water.lines(m1$A.species, col = "blue1") ## ----rainbow_data------------------------------------------------------------- file <- system.file("extdata/cpetc/SC10_Rainbow.csv", package = "CHNOSZ") rb <- read.csv(file, check.names = FALSE) ## ----rainbow_species, results="hide"------------------------------------------ basis(c("CO2", "H2", "NH4+", "H2O", "H2S", "H+")) species("CH4", -3) species(c("adenine", "cytosine", "aspartic acid", "deoxyribose", "CH4", "leucine", "tryptophan", "n-nonanoic acid"), -6) ## ----rainbow_affinity, message=FALSE------------------------------------------ a <- affinity(T = rb$T, CO2 = rb$CO2, H2 = rb$H2, `NH4+` = rb$`NH4+`, H2S = rb$H2S, pH = rb$pH) T <- convert(a$vals[[1]], "K") a$values <- lapply(a$values, convert, "G", T) a$values <- lapply(a$values, convert, "cal") a$values <- lapply(a$values, `*`, -0.001) ## ----rainbow_diagram, fig.margin=TRUE, fig.width=4, fig.height=4, out.width="100%", echo=FALSE, message=FALSE, cache=TRUE, fig.cap="Affinities of organic synthesis in a hydrothermal system, after Shock and Canovas (2010).", pngquant=pngquant, timeit=timeit---- diagram(a, balance = 1, ylim = c(-100, 100), ylab = quote(italic(A)*", kcal/mol"), col = rainbow(8), lwd = 2, bg = "slategray3") abline(h = 0, lty = 2, lwd = 2) ## ----rainbow_diagram, eval=FALSE---------------------------------------------- # diagram(a, balance = 1, ylim = c(-100, 100), ylab = quote(italic(A)*", kcal/mol"), # col = rainbow(8), lwd = 2, bg = "slategray3") # abline(h = 0, lty = 2, lwd = 2) ## ----PPM_basis, results="hide", message=FALSE--------------------------------- basis(c("FeS2", "H2S", "O2", "H2O")) species(c("pyrite", "magnetite")) species("pyrrhotite", "cr2", add = TRUE) ## ----PPM_affinity, message=FALSE---------------------------------------------- unlist(affinity(T = 300, P = 100)$values) ## ----PPM_setup, results="hide"------------------------------------------------ mod.buffer("PPM", "pyrrhotite", "cr2") basis(c("H2S", "O2"), c("PPM", "PPM")) ## ----PPM_activities, message=FALSE-------------------------------------------- unlist(affinity(T = 300, P = 100, return.buffer = TRUE)[1:3]) ## ----demo_buffer_noecho, fig.margin=TRUE, fig.width=4, fig.height=4, out.width="100%", message=FALSE, echo=FALSE, cache=TRUE, fig.cap="Values of logfH2 corresponding to mineral buffers or to given activities of aqueous species.", pngquant=pngquant, timeit=timeit---- demo(buffer, echo = FALSE) ## ----PPM_basis, echo = FALSE, results = "hide"-------------------------------- basis(c("FeS2", "H2S", "O2", "H2O")) species(c("pyrite", "magnetite")) species("pyrrhotite", "cr2", add = TRUE) ## ----PPM_setup, echo = FALSE, results = "hide", message = FALSE--------------- mod.buffer("PPM", "pyrrhotite", "cr2") basis(c("H2S", "O2"), c("PPM", "PPM")) ## ----PPM_affinity, message = FALSE-------------------------------------------- unlist(affinity(T = 300, P = 100)$values) ## ----demo_buffer, eval=FALSE-------------------------------------------------- # demo(buffer) ## ----bjerrum_diagram, fig.margin=TRUE, fig.width=3, fig.height=6, out.width="100%", echo=FALSE, results="hide", message=FALSE, cache=TRUE, fig.cap="Three views of carbonate speciation: affinity, activity, degree of formation.", pngquant=pngquant, timeit=timeit---- par(mfrow = c(3, 1)) basis("CHNOS+") species(c("CO2", "HCO3-", "CO3-2")) a25 <- affinity(pH = c(4, 13)) a150 <- affinity(pH = c(4, 13), T = 150) diagram(a25, dy = 0.4) diagram(a150, add = TRUE, names = FALSE, col = "red") e25 <- equilibrate(a25, loga.balance = -3) e150 <- equilibrate(a150, loga.balance = -3) diagram(e25, ylim = c(-6, 0), dy = 0.15) diagram(e150, add = TRUE, names = FALSE, col = "red") diagram(e25, alpha = TRUE, dy = -0.25) diagram(e150, alpha = TRUE, add = TRUE, names = FALSE, col = "red") ## ----bjerrum_diagram, echo=1:7, eval=FALSE------------------------------------ # par(mfrow = c(3, 1)) # basis("CHNOS+") # species(c("CO2", "HCO3-", "CO3-2")) # a25 <- affinity(pH = c(4, 13)) # a150 <- affinity(pH = c(4, 13), T = 150) # diagram(a25, dy = 0.4) # diagram(a150, add = TRUE, names = FALSE, col = "red") # e25 <- equilibrate(a25, loga.balance = -3) # e150 <- equilibrate(a150, loga.balance = -3) # diagram(e25, ylim = c(-6, 0), dy = 0.15) # diagram(e150, add = TRUE, names = FALSE, col = "red") # diagram(e25, alpha = TRUE, dy = -0.25) # diagram(e150, alpha = TRUE, add = TRUE, names = FALSE, col = "red") ## ----bjerrum_diagram, echo=8:11, eval=FALSE----------------------------------- # par(mfrow = c(3, 1)) # basis("CHNOS+") # species(c("CO2", "HCO3-", "CO3-2")) # a25 <- affinity(pH = c(4, 13)) # a150 <- affinity(pH = c(4, 13), T = 150) # diagram(a25, dy = 0.4) # diagram(a150, add = TRUE, names = FALSE, col = "red") # e25 <- equilibrate(a25, loga.balance = -3) # e150 <- equilibrate(a150, loga.balance = -3) # diagram(e25, ylim = c(-6, 0), dy = 0.15) # diagram(e150, add = TRUE, names = FALSE, col = "red") # diagram(e25, alpha = TRUE, dy = -0.25) # diagram(e150, alpha = TRUE, add = TRUE, names = FALSE, col = "red") ## ----bjerrum_diagram, echo=12:13, eval=FALSE---------------------------------- # par(mfrow = c(3, 1)) # basis("CHNOS+") # species(c("CO2", "HCO3-", "CO3-2")) # a25 <- affinity(pH = c(4, 13)) # a150 <- affinity(pH = c(4, 13), T = 150) # diagram(a25, dy = 0.4) # diagram(a150, add = TRUE, names = FALSE, col = "red") # e25 <- equilibrate(a25, loga.balance = -3) # e150 <- equilibrate(a150, loga.balance = -3) # diagram(e25, ylim = c(-6, 0), dy = 0.15) # diagram(e150, add = TRUE, names = FALSE, col = "red") # diagram(e25, alpha = TRUE, dy = -0.25) # diagram(e150, alpha = TRUE, add = TRUE, names = FALSE, col = "red") ## ----corundum, fig.margin=TRUE, fig.width=4, fig.height=4, out.width="100%", results="hide", message=FALSE, cache=TRUE, fig.cap="Solubility of corundum (green line) and equilibrium concentrations of aqueous species (black lines).", pngquant=pngquant, timeit=timeit---- add.OBIGT("SLOP98") basis(c("Al+3", "H2O", "H+", "O2")) species("corundum") iaq <- c("Al+3", "AlO2-", "AlOH+2", "AlO+", "HAlO2") s <- solubility(iaq, pH = c(0, 10), IS = 0, in.terms.of = "Al+3") diagram(s, type = "loga.balance", ylim = c(-10, 0), lwd = 4, col = "green3") diagram(s, add = TRUE, adj = c(0, 1, 2.1, -0.2, -1.5), dy = c(0, 0, 4, -0.3, 0.1)) legend("topright", c("25 °C", "1 bar"), text.font = 2, bty = "n") reset() ## ----Alberty------------------------------------------------------------------ oldnon <- nonideal("Alberty") ## ----subcrt_IS---------------------------------------------------------------- subcrt(c("MgATP-2", "MgHATP-", "MgH2ATP"), T = c(25, 100), IS = c(0, 0.25), property = "G")$out ## ----info_ATP, results="hide"------------------------------------------------- info(" ATP") ## ----T_100-------------------------------------------------------------------- T <- 100 ## ----ATP, eval=FALSE, echo=2:6------------------------------------------------ # par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) # basis("MgCHNOPS+") # species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) # a <- affinity(pH = c(3, 9), T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, tplot = FALSE) # title(main = describe.property("T", T)) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # Hlab <- substitute(italic(N)[H^`+`]) # plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) # a <- affinity(pH = c(3, 9), IS = 0.25, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # lines(a$vals[[1]], colSums(nH)) # legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) # ATP.H <- substitute("ATP and H"^`+`) # title(main = ATP.H) # species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) # Hplot <- function(pMg, IS = 0.25) { # basis("Mg+2", -pMg) # a <- affinity(pH = c(3, 9), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NH <- alphas * c(0:4, 0, 1, 2, 0) # lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) # } # plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) # lapply(2:6, Hplot) # legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) # ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) # title(main = ATP.H.Mg) # Mgplot <- function(pH, IS = 0.25) { # basis("pH", pH) # a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NMg <- alphas * species()$`Mg+` # lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) # } # Mglab <- substitute(italic(N)[Mg^`+2`]) # plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) # lapply(3:9, Mgplot) # legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) # title(main = ATP.H.Mg) ## ----ATP, eval=FALSE, echo=8:11----------------------------------------------- # par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) # basis("MgCHNOPS+") # species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) # a <- affinity(pH = c(3, 9), T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, tplot = FALSE) # title(main = describe.property("T", T)) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # Hlab <- substitute(italic(N)[H^`+`]) # plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) # a <- affinity(pH = c(3, 9), IS = 0.25, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # lines(a$vals[[1]], colSums(nH)) # legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) # ATP.H <- substitute("ATP and H"^`+`) # title(main = ATP.H) # species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) # Hplot <- function(pMg, IS = 0.25) { # basis("Mg+2", -pMg) # a <- affinity(pH = c(3, 9), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NH <- alphas * c(0:4, 0, 1, 2, 0) # lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) # } # plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) # lapply(2:6, Hplot) # legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) # ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) # title(main = ATP.H.Mg) # Mgplot <- function(pH, IS = 0.25) { # basis("pH", pH) # a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NMg <- alphas * species()$`Mg+` # lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) # } # Mglab <- substitute(italic(N)[Mg^`+2`]) # plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) # lapply(3:9, Mgplot) # legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) # title(main = ATP.H.Mg) ## ----ATP, eval=FALSE, echo=12:17---------------------------------------------- # par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) # basis("MgCHNOPS+") # species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) # a <- affinity(pH = c(3, 9), T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, tplot = FALSE) # title(main = describe.property("T", T)) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # Hlab <- substitute(italic(N)[H^`+`]) # plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) # a <- affinity(pH = c(3, 9), IS = 0.25, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # lines(a$vals[[1]], colSums(nH)) # legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) # ATP.H <- substitute("ATP and H"^`+`) # title(main = ATP.H) # species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) # Hplot <- function(pMg, IS = 0.25) { # basis("Mg+2", -pMg) # a <- affinity(pH = c(3, 9), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NH <- alphas * c(0:4, 0, 1, 2, 0) # lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) # } # plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) # lapply(2:6, Hplot) # legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) # ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) # title(main = ATP.H.Mg) # Mgplot <- function(pH, IS = 0.25) { # basis("pH", pH) # a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NMg <- alphas * species()$`Mg+` # lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) # } # Mglab <- substitute(italic(N)[Mg^`+2`]) # plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) # lapply(3:9, Mgplot) # legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) # title(main = ATP.H.Mg) ## ----ATP, eval=FALSE, echo=21------------------------------------------------- # par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) # basis("MgCHNOPS+") # species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) # a <- affinity(pH = c(3, 9), T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, tplot = FALSE) # title(main = describe.property("T", T)) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # Hlab <- substitute(italic(N)[H^`+`]) # plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) # a <- affinity(pH = c(3, 9), IS = 0.25, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # lines(a$vals[[1]], colSums(nH)) # legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) # ATP.H <- substitute("ATP and H"^`+`) # title(main = ATP.H) # species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) # Hplot <- function(pMg, IS = 0.25) { # basis("Mg+2", -pMg) # a <- affinity(pH = c(3, 9), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NH <- alphas * c(0:4, 0, 1, 2, 0) # lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) # } # plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) # lapply(2:6, Hplot) # legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) # ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) # title(main = ATP.H.Mg) # Mgplot <- function(pH, IS = 0.25) { # basis("pH", pH) # a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NMg <- alphas * species()$`Mg+` # lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) # } # Mglab <- substitute(italic(N)[Mg^`+2`]) # plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) # lapply(3:9, Mgplot) # legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) # title(main = ATP.H.Mg) ## ----ATP, eval=FALSE, echo=22:30---------------------------------------------- # par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) # basis("MgCHNOPS+") # species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) # a <- affinity(pH = c(3, 9), T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, tplot = FALSE) # title(main = describe.property("T", T)) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # Hlab <- substitute(italic(N)[H^`+`]) # plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) # a <- affinity(pH = c(3, 9), IS = 0.25, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # lines(a$vals[[1]], colSums(nH)) # legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) # ATP.H <- substitute("ATP and H"^`+`) # title(main = ATP.H) # species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) # Hplot <- function(pMg, IS = 0.25) { # basis("Mg+2", -pMg) # a <- affinity(pH = c(3, 9), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NH <- alphas * c(0:4, 0, 1, 2, 0) # lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) # } # plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) # lapply(2:6, Hplot) # legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) # ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) # title(main = ATP.H.Mg) # Mgplot <- function(pH, IS = 0.25) { # basis("pH", pH) # a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NMg <- alphas * species()$`Mg+` # lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) # } # Mglab <- substitute(italic(N)[Mg^`+2`]) # plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) # lapply(3:9, Mgplot) # legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) # title(main = ATP.H.Mg) ## ----ATP, eval=FALSE, echo=31:32---------------------------------------------- # par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) # basis("MgCHNOPS+") # species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) # a <- affinity(pH = c(3, 9), T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, tplot = FALSE) # title(main = describe.property("T", T)) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # Hlab <- substitute(italic(N)[H^`+`]) # plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) # a <- affinity(pH = c(3, 9), IS = 0.25, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # lines(a$vals[[1]], colSums(nH)) # legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) # ATP.H <- substitute("ATP and H"^`+`) # title(main = ATP.H) # species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) # Hplot <- function(pMg, IS = 0.25) { # basis("Mg+2", -pMg) # a <- affinity(pH = c(3, 9), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NH <- alphas * c(0:4, 0, 1, 2, 0) # lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) # } # plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) # lapply(2:6, Hplot) # legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) # ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) # title(main = ATP.H.Mg) # Mgplot <- function(pH, IS = 0.25) { # basis("pH", pH) # a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NMg <- alphas * species()$`Mg+` # lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) # } # Mglab <- substitute(italic(N)[Mg^`+2`]) # plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) # lapply(3:9, Mgplot) # legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) # title(main = ATP.H.Mg) ## ----ATP, eval=FALSE, echo=36:44---------------------------------------------- # par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) # basis("MgCHNOPS+") # species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) # a <- affinity(pH = c(3, 9), T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, tplot = FALSE) # title(main = describe.property("T", T)) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # Hlab <- substitute(italic(N)[H^`+`]) # plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) # a <- affinity(pH = c(3, 9), IS = 0.25, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # lines(a$vals[[1]], colSums(nH)) # legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) # ATP.H <- substitute("ATP and H"^`+`) # title(main = ATP.H) # species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) # Hplot <- function(pMg, IS = 0.25) { # basis("Mg+2", -pMg) # a <- affinity(pH = c(3, 9), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NH <- alphas * c(0:4, 0, 1, 2, 0) # lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) # } # plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) # lapply(2:6, Hplot) # legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) # ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) # title(main = ATP.H.Mg) # Mgplot <- function(pH, IS = 0.25) { # basis("pH", pH) # a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NMg <- alphas * species()$`Mg+` # lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) # } # Mglab <- substitute(italic(N)[Mg^`+2`]) # plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) # lapply(3:9, Mgplot) # legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) # title(main = ATP.H.Mg) ## ----ATP, eval=FALSE, echo=45:47---------------------------------------------- # par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) # basis("MgCHNOPS+") # species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) # a <- affinity(pH = c(3, 9), T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, tplot = FALSE) # title(main = describe.property("T", T)) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # Hlab <- substitute(italic(N)[H^`+`]) # plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) # a <- affinity(pH = c(3, 9), IS = 0.25, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # nH <- alphas * 0:4 # lines(a$vals[[1]], colSums(nH)) # legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) # ATP.H <- substitute("ATP and H"^`+`) # title(main = ATP.H) # species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) # Hplot <- function(pMg, IS = 0.25) { # basis("Mg+2", -pMg) # a <- affinity(pH = c(3, 9), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NH <- alphas * c(0:4, 0, 1, 2, 0) # lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) # } # plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) # lapply(2:6, Hplot) # legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) # ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) # title(main = ATP.H.Mg) # Mgplot <- function(pH, IS = 0.25) { # basis("pH", pH) # a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) # e <- equilibrate(a) # d <- diagram(e, alpha = TRUE, plot.it = FALSE) # alphas <- do.call(rbind, d$plotvals) # NMg <- alphas * species()$`Mg+` # lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) # } # Mglab <- substitute(italic(N)[Mg^`+2`]) # plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) # lapply(3:9, Mgplot) # legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) # title(main = ATP.H.Mg) ## ----ATP, fig.fullwidth=TRUE, fig.width=10, fig.height=2.5, dpi=hidpi, out.width="100%", echo=FALSE, message=FALSE, results="hide", fig.cap="Binding of H+ and Mg+2 to ATP at 100 °C and *I* = 0 M (first plot) or *I* = 0.25 M (third and fourth plots).", cache=TRUE, pngquant=pngquant, timeit=timeit---- par(mfrow = c(1, 4), mar = c(3.1, 3.6, 2.1, 1.6), mgp = c(1.8, 0.5, 0)) basis("MgCHNOPS+") species(c("ATP-4", "HATP-3", "H2ATP-2", "H3ATP-", "H4ATP")) a <- affinity(pH = c(3, 9), T = T) e <- equilibrate(a) d <- diagram(e, alpha = TRUE, tplot = FALSE) title(main = describe.property("T", T)) alphas <- do.call(rbind, d$plotvals) nH <- alphas * 0:4 Hlab <- substitute(italic(N)[H^`+`]) plot(a$vals[[1]], colSums(nH), type = "l", xlab = "pH", ylab=Hlab, lty=2, col=2) a <- affinity(pH = c(3, 9), IS = 0.25, T = T) e <- equilibrate(a) d <- diagram(e, alpha = TRUE, plot.it = FALSE) alphas <- do.call(rbind, d$plotvals) nH <- alphas * 0:4 lines(a$vals[[1]], colSums(nH)) legend("topright", legend = c("I = 0 M", "I = 0.25 M"), lty = 2:1, col = 2:1, cex = 0.8) ATP.H <- substitute("ATP and H"^`+`) title(main = ATP.H) species(c("MgATP-2", "MgHATP-", "MgH2ATP", "Mg2ATP"), add = TRUE) Hplot <- function(pMg, IS = 0.25) { basis("Mg+2", -pMg) a <- affinity(pH = c(3, 9), IS = IS, T = T) e <- equilibrate(a) d <- diagram(e, alpha = TRUE, plot.it = FALSE) alphas <- do.call(rbind, d$plotvals) NH <- alphas * c(0:4, 0, 1, 2, 0) lines(a$vals[[1]], colSums(NH), lty = 7 - pMg, col = 7 - pMg) } plot(c(3, 9), c(0, 2), type = "n", xlab = "pH", ylab = Hlab) lapply(2:6, Hplot) legend("topright", legend = paste("pMg = ", 2:6), lty = 5:1, col = 5:1, cex = 0.8) ATP.H.Mg <- substitute("ATP and H"^`+`~"and Mg"^`+2`) title(main = ATP.H.Mg) Mgplot <- function(pH, IS = 0.25) { basis("pH", pH) a <- affinity(`Mg+2` = c(-2, -7), IS = IS, T = T) e <- equilibrate(a) d <- diagram(e, alpha = TRUE, plot.it = FALSE) alphas <- do.call(rbind, d$plotvals) NMg <- alphas * species()$`Mg+` lines(-a$vals[[1]], colSums(NMg), lty = 10 - pH, col = 10 - pH) } Mglab <- substitute(italic(N)[Mg^`+2`]) plot(c(2, 7), c(0, 1.2), type = "n", xlab = "pMg", ylab = Mglab) lapply(3:9, Mgplot) legend("topright", legend = paste("pH = ", 3:9), lty = 7:1, col = 7:1, cex = 0.8) title(main = ATP.H.Mg) ## ----oldnon------------------------------------------------------------------- nonideal(oldnon) ## ----pinfo_LYSC_CHICK--------------------------------------------------------- p1 <- pinfo("LYSC_CHICK") p2 <- pinfo(c("SHH", "OLIG2"), "HUMAN") pinfo(c(p1, p2)) ## ----formula_LYSC_CHICK------------------------------------------------------- pl <- protein.length("LYSC_CHICK") pf <- protein.formula("LYSC_CHICK") list(length = pl, protein = pf, residue = pf / pl, ZC_protein = ZC(pf), ZC_residue = ZC(pf / pl)) ## ----subcrt_LYSC_CHICK, message=FALSE----------------------------------------- subcrt("LYSC_CHICK")$out[[1]][1:6, ] ## ----protein_Cp, fig.margin=TRUE, fig.width=4, fig.height=4, small.mar=TRUE, out.width="100%", echo=FALSE, message=FALSE, fig.cap='The heat capacity calculated by group additivity closely approximates experimental values for aqueous proteins. For a related figure showing the effects of ionization in the calculations, see `?ionize.aa`.', cache=TRUE, pngquant=pngquant, timeit=timeit---- PM90 <- read.csv(system.file("extdata/cpetc/PM90.csv", package = "CHNOSZ")) plength <- protein.length(colnames(PM90)[2:5]) Cp_expt <- t(t(PM90[, 2:5]) / plength) matplot(PM90[, 1], Cp_expt, type = "p", pch = 19, xlab = axis.label("T"), ylab = axis.label("Cp0"), ylim = c(110, 280)) for(i in 1:4) { pname <- colnames(Cp_expt)[i] aq <- subcrt(pname, "aq", T = seq(0, 150))$out[[1]] cr <- subcrt(pname, "cr", T = seq(0, 150))$out[[1]] lines(aq$T, aq$Cp / plength[i], col = i) lines(cr$T, cr$Cp / plength[i], col = i, lty = 2) } legend("right", legend = colnames(Cp_expt), col = 1:4, pch = 19, lty = 1, bty = "n", cex = 0.9) legend("bottomright", legend = c("experimental", "calculated (aq)", "calculated (cr)"), lty = c(NA, 1, 2), pch = c(19, NA, NA), bty = "n") ## ----protein_Cp, eval=FALSE, echo=1:5----------------------------------------- # PM90 <- read.csv(system.file("extdata/cpetc/PM90.csv", package = "CHNOSZ")) # plength <- protein.length(colnames(PM90)[2:5]) # Cp_expt <- t(t(PM90[, 2:5]) / plength) # matplot(PM90[, 1], Cp_expt, type = "p", pch = 19, # xlab = axis.label("T"), ylab = axis.label("Cp0"), ylim = c(110, 280)) # for(i in 1:4) { # pname <- colnames(Cp_expt)[i] # aq <- subcrt(pname, "aq", T = seq(0, 150))$out[[1]] # cr <- subcrt(pname, "cr", T = seq(0, 150))$out[[1]] # lines(aq$T, aq$Cp / plength[i], col = i) # lines(cr$T, cr$Cp / plength[i], col = i, lty = 2) # } # legend("right", legend = colnames(Cp_expt), # col = 1:4, pch = 19, lty = 1, bty = "n", cex = 0.9) # legend("bottomright", legend = c("experimental", "calculated (aq)", # "calculated (cr)"), lty = c(NA, 1, 2), pch = c(19, NA, NA), bty = "n") ## ----protein_Cp, eval=FALSE, echo=-(1:5)-------------------------------------- # PM90 <- read.csv(system.file("extdata/cpetc/PM90.csv", package = "CHNOSZ")) # plength <- protein.length(colnames(PM90)[2:5]) # Cp_expt <- t(t(PM90[, 2:5]) / plength) # matplot(PM90[, 1], Cp_expt, type = "p", pch = 19, # xlab = axis.label("T"), ylab = axis.label("Cp0"), ylim = c(110, 280)) # for(i in 1:4) { # pname <- colnames(Cp_expt)[i] # aq <- subcrt(pname, "aq", T = seq(0, 150))$out[[1]] # cr <- subcrt(pname, "cr", T = seq(0, 150))$out[[1]] # lines(aq$T, aq$Cp / plength[i], col = i) # lines(cr$T, cr$Cp / plength[i], col = i, lty = 2) # } # legend("right", legend = colnames(Cp_expt), # col = 1:4, pch = 19, lty = 1, bty = "n", cex = 0.9) # legend("bottomright", legend = c("experimental", "calculated (aq)", # "calculated (cr)"), lty = c(NA, 1, 2), pch = c(19, NA, NA), bty = "n") ## ----protein_ionization, fig.margin=TRUE, fig.width=4, fig.height=4, small.mar=TRUE, out.width="100%", echo=FALSE, results="hide", message=FALSE, fig.cap='Affinity of ionization of proteins. See [demo(ionize)](../demo) for ionization properties calculated as a function of temperature and pH.', cache=TRUE, pngquant=pngquant, timeit=timeit---- ip <- pinfo(c("CYC_BOVIN", "LYSC_CHICK", "MYG_PHYCA", "RNAS1_BOVIN")) basis("CHNOS+") a_ion <- affinity(pH = c(0, 14), iprotein = ip) basis("CHNOS") a_nonion <- affinity(iprotein = ip) plot(c(0, 14), c(50, 300), xlab = "pH", ylab = quote(italic(A/2.303*RT)), type="n") for(i in 1:4) { A_ion <- as.numeric(a_ion$values[[i]]) A_nonion <- as.numeric(a_nonion$values[[i]]) lines(a_ion$vals[[1]], A_ion - A_nonion, col=i) } legend("topright", legend = a_ion$species$name, col = 1:4, lty = 1, bty = "n", cex = 0.9) ## ----protein_ionization, eval=FALSE------------------------------------------- # ip <- pinfo(c("CYC_BOVIN", "LYSC_CHICK", "MYG_PHYCA", "RNAS1_BOVIN")) # basis("CHNOS+") # a_ion <- affinity(pH = c(0, 14), iprotein = ip) # basis("CHNOS") # a_nonion <- affinity(iprotein = ip) # plot(c(0, 14), c(50, 300), xlab = "pH", ylab = quote(italic(A/2.303*RT)), type="n") # for(i in 1:4) { # A_ion <- as.numeric(a_ion$values[[i]]) # A_nonion <- as.numeric(a_nonion$values[[i]]) # lines(a_ion$vals[[1]], A_ion - A_nonion, col=i) # } # legend("topright", legend = a_ion$species$name, # col = 1:4, lty = 1, bty = "n", cex = 0.9) ## ----basis_CHNOS, echo=FALSE, results="hide"---------------------------------- basis("CHNOS") ## ----species_protein, results="hide", message=FALSE, echo=1:2----------------- species(c("CYC_BOVIN", "LYSC_CHICK", "MYG_PHYCA", "RNAS1_BOVIN")) a_nonion_species <- affinity() ## ----nonion_species_values---------------------------------------------------- unlist(a_nonion_species$values) ## ----nonion_values------------------------------------------------------------ unlist(a_nonion$values) ## ----rubisco_svg, echo=FALSE, results="hide", fig.margin=TRUE, fig.width=4, fig.height=4, small.mar=TRUE, out.width="100%", fig.ext='svg', custom.plot=TRUE, embed.tag=TRUE, fig.cap='Average oxidation state of carbon in Rubisco compared with optimal growth temperature of organisms. **This is an interactive image.** Move the mouse over the points to show the names of the organisms, and click to open a reference in a new window. (Made with [**RSVGTipsDevice**](https://cran.r-project.org/package=RSVGTipsDevice) using code that can be found in the source of this document.)'---- ## copies the premade SVG image to the knitr figure path file.copy("rubisco.svg", fig_path(".svg")) ## the code for making the SVG image -- not "live" in the vignette because RSVGTipsDevice isn't available on Windows #if(require(RSVGTipsDevice)) { # datfile <- system.file("extdata/cpetc/rubisco.csv", package = "CHNOSZ") # fastafile <- system.file("extdata/protein/rubisco.fasta", package = "CHNOSZ") # dat <- read.csv(datfile) # aa <- read.fasta(fastafile) # Topt <- (dat$T1 + dat$T2) / 2 # idat <- match(dat$ID, substr(aa$protein, 4, 9)) # aa <- aa[idat, ] # ZC <- ZC(protein.formula(aa)) # pch <- match(dat$domain, c("E", "B", "A")) - 1 # col <- match(dat$domain, c("A", "B", "E")) + 1 # # because the tooltip titles in the SVG file are shown by recent browsers, # # we do not need to draw the tooltips explicitly, so set toolTipMode=0 # devSVGTips("rubisco.svg", toolTipMode=0, title="Rubisco") # par(cex=1.4) # # unfortunately, plotmath can't be used with devSVGTips, # # so axis labels here don't contain italics. # plot(Topt, ZC, type="n", xlab="T, °C", ylab="ZC") # n <- rep(1:9, 3) # for(i in seq_along(Topt)) { # # adjust cex to make the symbols look the same size # cex <- ifelse(pch[i]==1, 2.5, 3.5) # points(Topt[i], ZC[i], pch=pch[i], cex=cex, col=col[i]) # URL <- dat$URL[i] # setSVGShapeURL(URL, target="_blank") # setSVGShapeContents(paste0("", dat$species[i], "")) # text(Topt[i], ZC[i], n[i], cex = 1.2) # } # abline(v = c(36, 63), lty = 2, col = "grey") # legend("topright", legend = c("Archaea", "Bacteria", "Eukaryota"), # pch = c(2, 1, 0), col = 2:4, cex=1.5, pt.cex = c(3, 2.3, 3), bty="n") # dev.off() #} ## ----rubisco_ZC, fig.keep="none", message=FALSE------------------------------- datfile <- system.file("extdata/cpetc/rubisco.csv", package = "CHNOSZ") fastafile <- system.file("extdata/protein/rubisco.fasta", package = "CHNOSZ") dat <- read.csv(datfile) aa <- read.fasta(fastafile) Topt <- (dat$T1 + dat$T2) / 2 idat <- match(dat$ID, substr(aa$protein, 4, 9)) aa <- aa[idat, ] ZC <- ZC(protein.formula(aa)) pch <- match(dat$domain, c("E", "B", "A")) - 1 col <- match(dat$domain, c("A", "B", "E")) + 1 plot(Topt, ZC, pch = pch, cex = 2, col = col, xlab = expression(list(italic(T)[opt], degree*C)), ylab = expression(italic(Z)[C])) text(Topt, ZC, rep(1:9, 3), cex = 0.8) abline(v = c(36, 63), lty = 2, col = "grey") legend("topright", legend = c("Archaea", "Bacteria", "Eukaryota"), pch = c(2, 1, 0), col = 2:4, pt.cex = 2) ## ----rubisco_O2, fig.margin=TRUE, fig.width=4, fig.height=4, small.mar=TRUE, out.width="100%", echo=FALSE, results="hide", message=FALSE, fig.cap="Elemental compositions of proteins projected into different sets of basis species.", cache=TRUE, pngquant=pngquant, timeit=timeit---- layout(matrix(1:4, nrow = 2)) par(mgp = c(1.8, 0.5, 0)) pl <- protein.length(aa) ZClab <- axis.label("ZC") nO2lab <- expression(bar(italic(n))[O[2]]) nH2Olab <- expression(bar(italic(n))[H[2]*O]) lapply(c("CHNOS", "QEC"), function(thisbasis) { basis(thisbasis) pb <- protein.basis(aa) nO2 <- pb[, "O2"] / pl plot(ZC, nO2, pch = pch, col = col, xlab = ZClab, ylab = nO2lab) nH2O <- pb[, "H2O"] / pl plot(ZC, nH2O, pch = pch, col = col, xlab = ZClab, ylab = nH2Olab) mtext(thisbasis, font = 2) }) ## ----rubisco_O2, eval=FALSE--------------------------------------------------- # layout(matrix(1:4, nrow = 2)) # par(mgp = c(1.8, 0.5, 0)) # pl <- protein.length(aa) # ZClab <- axis.label("ZC") # nO2lab <- expression(bar(italic(n))[O[2]]) # nH2Olab <- expression(bar(italic(n))[H[2]*O]) # lapply(c("CHNOS", "QEC"), function(thisbasis) { # basis(thisbasis) # pb <- protein.basis(aa) # nO2 <- pb[, "O2"] / pl # plot(ZC, nO2, pch = pch, col = col, xlab = ZClab, ylab = nO2lab) # nH2O <- pb[, "H2O"] / pl # plot(ZC, nH2O, pch = pch, col = col, xlab = ZClab, ylab = nH2Olab) # mtext(thisbasis, font = 2) # }) ## ----yeastgfp----------------------------------------------------------------- protein <- c("YDL195W", "YHR098C", "YIL109C", "YLR208W", "YNL049C", "YPL085W") abundance <- c(1840, 12200, NA, 21400, 1720, 358) ina <- is.na(abundance) ## ----add_protein_yeast, message=FALSE----------------------------------------- ip <- match(protein[!ina], thermo()$protein$protein) ## ----unitize------------------------------------------------------------------ pl <- protein.length(ip) logact <- unitize(numeric(5), pl) logabundance <- unitize(log10(abundance[!ina]), pl) ## ----yeastplot, eval=FALSE, echo=1:5------------------------------------------ # par(mfrow = c(1, 3)) # basis("CHNOS+") # a <- affinity(O2 = c(-80, -73), iprotein = ip, loga.protein = logact) # e <- equilibrate(a) # diagram(e, ylim = c(-5, -2), col = 1:5, lwd = 2) # e <- equilibrate(a, normalize = TRUE) # diagram(e, ylim = c(-5, -2.5), col = 1:5, lwd = 2) # abline(h = logabundance, lty = 1:5, col = 1:5) ## ----yeastplot, eval=FALSE, echo=6:8------------------------------------------ # par(mfrow = c(1, 3)) # basis("CHNOS+") # a <- affinity(O2 = c(-80, -73), iprotein = ip, loga.protein = logact) # e <- equilibrate(a) # diagram(e, ylim = c(-5, -2), col = 1:5, lwd = 2) # e <- equilibrate(a, normalize = TRUE) # diagram(e, ylim = c(-5, -2.5), col = 1:5, lwd = 2) # abline(h = logabundance, lty = 1:5, col = 1:5) ## ----yeastplot, fig.width=6, fig.height=2.5, dpi=hidpi, out.width="100%", echo=FALSE, message=FALSE, results="hide", cache=TRUE, fig.cap="ER-to-Golgi proteins: calculations without and with length normalization.", pngquant=pngquant, timeit=timeit---- par(mfrow = c(1, 3)) basis("CHNOS+") a <- affinity(O2 = c(-80, -73), iprotein = ip, loga.protein = logact) e <- equilibrate(a) diagram(e, ylim = c(-5, -2), col = 1:5, lwd = 2) e <- equilibrate(a, normalize = TRUE) diagram(e, ylim = c(-5, -2.5), col = 1:5, lwd = 2) abline(h = logabundance, lty = 1:5, col = 1:5) ## ----read_csv----------------------------------------------------------------- file <- system.file("extdata/protein/POLG.csv", package = "CHNOSZ") aa_POLG <- read.csv(file, as.is = TRUE, nrows = 5) ## ----read_fasta, message=FALSE------------------------------------------------ file <- system.file("extdata/protein/EF-Tu.aln", package = "CHNOSZ") aa_Ef <- read.fasta(file, iseq = 1:2) ## ----seq2aa------------------------------------------------------------------- aa_PRIO <- seq2aa(" MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQP HGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGA VVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCV NITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGSSMVLFSSPPV ILLISFLIFLIVG ", "PRIO_HUMAN") ## ----protein_length----------------------------------------------------------- myaa <- rbind(aa_Ef, aa_PRIO) protein.length(myaa) ## ----thermo_refs_table, eval=FALSE-------------------------------------------- # thermo.refs() ## shows table in a browser ## ----width180, include=FALSE------------------------------------------------------------------------------------------------------------------------------------------------------ options(width = 180) ## ----thermo_refs_numeric---------------------------------------------------------------------------------------------------------------------------------------------------------- iATP <- info("ATP-4") iMgATP <- info("MgATP-2") thermo.refs(c(iATP, iMgATP)) ## ----thermo_refs_character-------------------------------------------------------------------------------------------------------------------------------------------------------- thermo.refs(c("HDNB78", "MGN03")) ## ----thermo_refs_subcrt, message=FALSE-------------------------------------------------------------------------------------------------------------------------------------------- sres <- subcrt(c("C2H5OH", "O2", "CO2", "H2O"), c(-1, -3, 2, 3)) thermo.refs(sres) ## ----width80, include=FALSE--------------------------------------------------- options(width = 80) ## ----thermo_refs_browse, eval=FALSE------------------------------------------- # iFo <- info("forsterite") # ref <- thermo.refs(iFo) # browseURL(ref$URL) ## opens a link to worldcat.org ## ----info_S3, results="hide"-------------------------------------------------- info(info("S3-")) ## ----check_OBIGT-------------------------------------------------------------- file <- system.file("extdata/adds/OBIGT_check.csv", package = "CHNOSZ") dat <- read.csv(file, as.is = TRUE) nrow(dat) ## ----citation_CHNOSZ, results="asis", echo = FALSE---------------------------- cref <- citation("CHNOSZ") print(cref[1], style = "html") ## ----citation_multimetal, results="asis", echo = FALSE------------------------ print(cref[2], style = "html") ## ----maintainer_CHNOSZ-------------------------------------------------------- maintainer("CHNOSZ") ## ----file_edit_anintro, eval=FALSE-------------------------------------------- # file.edit(system.file("doc/anintro.Rmd", package = "CHNOSZ")) ## ----the_end------------------------------------------------------------------ ###### ## ## ## ## ###### ##### ##### ## ##===## ## \\## ## ## \\ // ###### ## ## ## ## ###### ##### ##### ## ----sessionInfo-------------------------------------------------------------- sessionInfo()